PDB entry 1aq5
View 1aq5 on RCSB PDB site
Description: high-resolution solution nmr structure of the trimeric coiled-coil domain of chicken cartilage matrix protein, 20 structures
Class: coiled-coil
Keywords: coiled-coil, heptad repeat, interchain disulfide bonds, oligomerization domain, trimer, cartilage matrix protein, matrilin-1, noncollagenous extracellular protein
Deposited on
1997-08-07, released
1998-02-11
The last revision prior to the SCOPe 2.08 freeze date was dated
2021-01-13, with a file datestamp of
2021-01-08.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: cartilage matrix protein
Species: Gallus gallus [TaxId:9031]
Gene: CMP
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.08: d1aq5a1, d1aq5a2 - Chain 'B':
Compound: cartilage matrix protein
Species: Gallus gallus [TaxId:9031]
Gene: CMP
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.08: d1aq5b1, d1aq5b2 - Chain 'C':
Compound: cartilage matrix protein
Species: Gallus gallus [TaxId:9031]
Gene: CMP
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.08: d1aq5c1, d1aq5c2
PDB Chain Sequences:
- Chain 'A':
Sequence; same for both SEQRES and ATOM records: (download)
>1aq5A (A:)
gshmeedpcecksivkfqtkveelintlqqkleavakriealenkii
- Chain 'B':
Sequence; same for both SEQRES and ATOM records: (download)
>1aq5B (B:)
gshmeedpcecksivkfqtkveelintlqqkleavakriealenkii
- Chain 'C':
Sequence; same for both SEQRES and ATOM records: (download)
>1aq5C (C:)
gshmeedpcecksivkfqtkveelintlqqkleavakriealenkii