PDB entry 1aq5

View 1aq5 on RCSB PDB site
Description: high-resolution solution nmr structure of the trimeric coiled-coil domain of chicken cartilage matrix protein, 20 structures
Class: coiled-coil
Keywords: coiled-coil, heptad repeat, interchain disulfide bonds, oligomerization domain, trimer, cartilage matrix protein, matrilin-1, noncollagenous extracellular protein
Deposited on 1997-08-07, released 1998-02-11
The last revision prior to the SCOPe 2.08 freeze date was dated 2021-01-13, with a file datestamp of 2021-01-08.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cartilage matrix protein
    Species: Gallus gallus [TaxId:9031]
    Gene: CMP
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1aq5a1, d1aq5a2
  • Chain 'B':
    Compound: cartilage matrix protein
    Species: Gallus gallus [TaxId:9031]
    Gene: CMP
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1aq5b1, d1aq5b2
  • Chain 'C':
    Compound: cartilage matrix protein
    Species: Gallus gallus [TaxId:9031]
    Gene: CMP
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1aq5c1, d1aq5c2

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1aq5A (A:)
    gshmeedpcecksivkfqtkveelintlqqkleavakriealenkii
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1aq5B (B:)
    gshmeedpcecksivkfqtkveelintlqqkleavakriealenkii
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1aq5C (C:)
    gshmeedpcecksivkfqtkveelintlqqkleavakriealenkii