PDB entry 1aq3

View 1aq3 on RCSB PDB site
Description: bacteriophage ms2 capsid protein/RNA complex
Class: Virus/RNA
Keywords: COMPLEX (COAT PROTEIN/RNA),COAT PROTEIN, RNA-BINDING, VIRAL PROTEIN CAPSID, RNA FRAGMENT, Icosahedral virus, Virus/RNA COMPLEX
Deposited on 1997-08-06, released 1997-12-24
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-19.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.204
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (bacteriophage ms2 coat protein)
    Species: Enterobacteria phage MS2 [TaxId:12022]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03612 (0-128)
      • engineered (58)
    Domains in SCOPe 2.07: d1aq3a_
  • Chain 'B':
    Compound: protein (bacteriophage ms2 coat protein)
    Species: Enterobacteria phage MS2 [TaxId:12022]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03612 (0-128)
      • engineered (58)
    Domains in SCOPe 2.07: d1aq3b_
  • Chain 'C':
    Compound: protein (bacteriophage ms2 coat protein)
    Species: Enterobacteria phage MS2 [TaxId:12022]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03612 (0-128)
      • engineered (58)
    Domains in SCOPe 2.07: d1aq3c_
  • Chain 'R':
    Compound: RNA (5'-r(*ap*cp*ap*up*gp*ap*gp*gp*ap*up*up*ap*cp*cp*cp*ap*u p*gp*u)-3')
  • Chain 'S':
    Compound: RNA (5'-r(*ap*cp*ap*up*gp*ap*gp*gp*ap*up*up*ap*cp*cp*cp*ap*u p*gp*u)-3')
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1aq3A (A:)
    asnftqfvlvdnggtgdvtvapsnfangvaewissnsrsqaykvtcsvrqssaqnrkysi
    kvevpkvatqtvggvelpvaawrsylnmeltipifatnsdcelivkamqgllkdgnpips
    aiaansgiy
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1aq3B (B:)
    asnftqfvlvdnggtgdvtvapsnfangvaewissnsrsqaykvtcsvrqssaqnrkysi
    kvevpkvatqtvggvelpvaawrsylnmeltipifatnsdcelivkamqgllkdgnpips
    aiaansgiy
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1aq3C (C:)
    asnftqfvlvdnggtgdvtvapsnfangvaewissnsrsqaykvtcsvrqssaqnrkysi
    kvevpkvatqtvggvelpvaawrsylnmeltipifatnsdcelivkamqgllkdgnpips
    aiaansgiy
    

  • Chain 'R':
    No sequence available.

  • Chain 'S':
    No sequence available.