PDB entry 1aq2

View 1aq2 on RCSB PDB site
Description: phosphoenolpyruvate carboxykinase
Deposited on 1997-08-05, released 1998-10-14
The last revision prior to the SCOP 1.55 freeze date was dated 1998-10-14, with a file datestamp of 1998-10-14.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.218
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.55: d1aq2__

PDB Chain Sequences:

  • Chain ' ':
    Sequence, based on SEQRES records: (download)
    >1aq2_ (-)
    nngltpqeleaygisdvhdivynpsydllyqeeldpsltgyergvltnlgavavdtgift
    grspkdkyivrddttrdtfwwadkgkgkndnkplspetwqhlkglvtrqlsgkrlfvvda
    fcganpdtrlsvrfitevawqahfvknmfirpsdeelagfkpdfivmngakctnpqwkeq
    glnsenfvafnltermqliggtwyggemkkgmfsmmnyllplkgiasmhcsanvgekgdv
    avffglsgtgkttlstdpkrrligddehgwdddgvfnfeggcyaktiklskeaepeiyna
    irrdallenvtvredgtidfddgsktentrvsypiyhidnivkpvskaghatkvifltad
    afgvlppvsrltadqtqyhflsgftaklagtergiteptptfsacfgaaflslhptqyae
    vlvkrmqaagaqaylvntgwngtgkrisikdtraiidailngsldnaetftlpmfnlaip
    telpgvdtkildprntyaspeqwqekaetlaklfidnfdkytdtpagaalvaagpkl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1aq2_ (-)
    nngltpqeleaygisdvhdivynpsydllyqeeldpsltgyergvltnlgavavdtgift
    grspkdkyivrddttrdtfwwadkgkgkndnkplspetwqhlkglvtrqlsgkrlfvvda
    fcganpdtrlsvrfitevawqahfvknmfirpsdeelagfkpdfivmngakctnpqwkeq
    glnsenfvafnltermqliggtwyggemkkgmfsmmnyllplkgiasmhcsanvgekgdv
    avffglsgtgkttlstdpkrrligddehgwdddgvfnfeggcyaktiklskeaepeiyna
    irrdallenvtvredgtidfddgsktentrvsypiyhidnivkpvskaghatkvifltad
    afgvlppvsrltadqtqyhflsgftaklagtiteptptfsacfgaaflslhptqyaevlv
    krmqaagaqaylvntgwngtgkrisikdtraiidailngsldnaetftlpmfnlaiptel
    pgvdtkildprntyaspeqwqekaetlaklfidnfdkytdtpagaalvaagpkl