PDB entry 1aq0

View 1aq0 on RCSB PDB site
Description: barley 1,3-1,4-beta-glucanase in monoclinic space group
Class: hydrolase
Keywords: hydrolase, glycosidase, glycoprotein, glycosylated protein
Deposited on 1997-08-05, released 1998-02-11
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-07-29, with a file datestamp of 2020-07-09.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 1,3-1,4-beta-glucanase
    Species: Hordeum vulgare [TaxId:4513]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P12257 (0-305)
      • conflict (23)
    Domains in SCOPe 2.08: d1aq0a_
  • Chain 'B':
    Compound: 1,3-1,4-beta-glucanase
    Species: Hordeum vulgare [TaxId:4513]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P12257 (0-305)
      • conflict (23)
    Domains in SCOPe 2.08: d1aq0b_
  • Heterogens: ACT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1aq0A (A:)
    igvcygmsannlpaastvvsmfksngiksmrlyapnqaalqavggtginvvvgapndvls
    nlaaspaaaaswvksniqaypkvsfryvcvgnevaggatrnlvpamknvhgalvaaglgh
    ikvttsvsqailgvfsppsagsftgeaaafmgpvvqflartnaplmaniypylawaynps
    amdmgyalfnasgtvvrdgaygyqnlfdttvdafytamgkhggssvklvvsesgwpsggg
    taatpanarfynqhlinhvgrgtprhpgaietyifamfnenqkdsgveqnwglfypnmqh
    vypinf
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1aq0B (B:)
    igvcygmsannlpaastvvsmfksngiksmrlyapnqaalqavggtginvvvgapndvls
    nlaaspaaaaswvksniqaypkvsfryvcvgnevaggatrnlvpamknvhgalvaaglgh
    ikvttsvsqailgvfsppsagsftgeaaafmgpvvqflartnaplmaniypylawaynps
    amdmgyalfnasgtvvrdgaygyqnlfdttvdafytamgkhggssvklvvsesgwpsggg
    taatpanarfynqhlinhvgrgtprhpgaietyifamfnenqkdsgveqnwglfypnmqh
    vypinf