PDB entry 1apx

View 1apx on RCSB PDB site
Description: crystal structure of recombinant ascorbate peroxidase
Deposited on 1995-02-01, released 1996-03-08
The last revision prior to the SCOP 1.59 freeze date was dated 1996-03-08, with a file datestamp of 1996-03-11.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.193
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.59: d1apxa_
  • Chain 'B':
    Domains in SCOP 1.59: d1apxb_
  • Chain 'C':
    Domains in SCOP 1.59: d1apxc_
  • Chain 'D':
    Domains in SCOP 1.59: d1apxd_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1apxA (A:)
    gksyptvspdyqkaiekakrklrgfiaekkcaplilrlawhsagtfdsktktggpfgtik
    hqaelahganngldiavrllepikeqfpivsyadfyqlagvvaveitggpevpfhpgred
    kpepppegrlpdatkgsdhlrdvfgkamglsdqdivalsgghtigaahkersgfegpwts
    nplifdnsyftelltgekdgllqlpsdkalltdsvfrplvekyaadedvffadyaeahlk
    lselgfaea
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1apxB (B:)
    gksyptvspdyqkaiekakrklrgfiaekkcaplilrlawhsagtfdsktktggpfgtik
    hqaelahganngldiavrllepikeqfpivsyadfyqlagvvaveitggpevpfhpgred
    kpepppegrlpdatkgsdhlrdvfgkamglsdqdivalsgghtigaahkersgfegpwts
    nplifdnsyftelltgekdgllqlpsdkalltdsvfrplvekyaadedvffadyaeahlk
    lselgfaea
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1apxC (C:)
    gksyptvspdyqkaiekakrklrgfiaekkcaplilrlawhsagtfdsktktggpfgtik
    hqaelahganngldiavrllepikeqfpivsyadfyqlagvvaveitggpevpfhpgred
    kpepppegrlpdatkgsdhlrdvfgkamglsdqdivalsgghtigaahkersgfegpwts
    nplifdnsyftelltgekdgllqlpsdkalltdsvfrplvekyaadedvffadyaeahlk
    lselgfaea
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1apxD (D:)
    gksyptvspdyqkaiekakrklrgfiaekkcaplilrlawhsagtfdsktktggpfgtik
    hqaelahganngldiavrllepikeqfpivsyadfyqlagvvaveitggpevpfhpgred
    kpepppegrlpdatkgsdhlrdvfgkamglsdqdivalsgghtigaahkersgfegpwts
    nplifdnsyftelltgekdgllqlpsdkalltdsvfrplvekyaadedvffadyaeahlk
    lselgfaea