PDB entry 1apu

View 1apu on RCSB PDB site
Description: Crystallographic analysis of a pepstatin analogue binding to the aspartyl proteinase penicillopepsin at 1.8 angstroms resolution
Class: hydrolase/hydrolase inhibitor
Keywords: ACID PROTEINASE, HYDROLASE-HYDROLASE INHIBITOR complex
Deposited on 1991-12-16, released 1994-01-31
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-06-04, with a file datestamp of 2014-05-30.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.131
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'E':
    Compound: protein (penicillopepsin)
    Species: Penicillium janthinellum [TaxId:5079]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1apue_
  • Chain 'I':
    Compound: pepstatin analogue isovaleryl-val-val-sta-o-et
    Database cross-references and differences (RAF-indexed):
    • PDB 1APU (0-3)
  • Heterogens: MAN, HOH

PDB Chain Sequences:

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1apuE (E:)
    aasgvatntptandeeyitpvtiggttlnlnfdtgsadlwvfstelpasqqsghsvynps
    atgkelsgytwsisygdgssasgnvftdsvtvggvtahgqavqaaqqisaqfqqdtnndg
    llglafssintvqpqsqttffdtvksslaqplfavalkhqqpgvydfgfidsskytgslt
    ytgvdnsqgfwsfnvdsytagsqsgdgfsgiadtgttllllddsvvsqyysqvsgaqqds
    naggyvfdcstnlpdfsvsisgytatvpgslinygpsgdgstclggiqsnsgigfsifgd
    iflksqyvvfdsdgpqlgfapqa
    

  • Chain 'I':
    No sequence available.