PDB entry 1aps

View 1aps on RCSB PDB site
Description: three-dimensional structure of acylphosphatase. refinement and structure analysis
Class: hydrolase(acting on acid anhydrides)
Keywords: hydrolase(acting on acid anhydrides)
Deposited on 1991-02-20, released 1992-07-15
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: acylphosphatase
  Species: Equus caballus [TaxId:9796]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P00818 (0-97)
  Domains in SCOPe 2.08: d1apsa_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1apsA (A:)
  starplksvdyevfgrvqgvcfrmyaedearkigvvgwvkntskgtvtgqvqgpeekvns
  mkswlskvgspssridrtnfsnektiskleysnfsvry