PDB entry 1apr

View 1apr on RCSB PDB site
Description: homology among acid proteases, comparison of crystal structures at 3 angstroms resolution of acid proteases from rhizopus chinensis and endothia parasitica
Deposited on 1979-08-01, released 1979-09-07
The last revision was dated 1987-07-16, with a file datestamp of 2007-04-25.
Experiment type: XRAY
Resolution: N/A
R-factor: N/A
AEROSPACI score: -0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    no info in PDB for this chain
  • Chain 'p':
    no info in PDB for this chain

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records:
    >1apr_ (-)
gvgtvpmtdygndveyygqvtigtpgksfnlnfdtgssnlwvgsvqcqasgckggrdkfn
psdgstfkatgydasigygdgsasgvlgydtvqvggidvtggpqiqlaqrlggggfpgdn
dgllglgfdtlsitpqsstnafdqvsaqgkviqpvfvvylaasnisdgdftmpgwidnky
ggtllntnidagegywalnvtgatadstylgaifqaildtgtsllilpdeaavgnlvgfa
gaqdaalggfviactsagfksipwsiysaifeiitalgnaeddsgctsgigasslgeail
gdqflkqqyvvfdrdngirlapva

  • Chain 'p':
    No sequence available.