PDB entry 1app

View 1app on RCSB PDB site
Description: penicillopepsin from penicillium janthinellum crystal structure at 2.8 angstroms and sequence homology with porcine pepsin
Deposited on 1979-12-06, released 1979-12-06
The last revision was dated 1979-12-06, with a file datestamp of 2007-04-25.
Experiment type: XRAY
Resolution: N/A
R-factor: N/A
AEROSPACI score: -0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    no info in PDB for this chain
  • Chain 'p':
    no info in PDB for this chain

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records:
    >1app_ (-)
aasgvatntptandeeyitpvtiggttlnlnfdtgsadlwvfstelpasqqsghsvynps
atgkelsgytwsisygdgssasgnvftdsvtvggvtahgqavqaaqqisaqfqqdtnndg
llglafssintvqpqsqttffdtvksslaqplfavalkhqqpgvydfgfidsskytgslt
ytgvdnsqgfwsfnvdsytagsqsgdgfsgiadtgttllllddsvvsqyysqvsgaqqds
naggyvfdcsssvpdfsvsisgytatvpgslinygpsgngstclggiqsnsgigflifgd
iflksqyvvfdsdgpqlgfapqa

  • Chain 'p':
    No sequence available.