PDB entry 1apo

View 1apo on RCSB PDB site
Description: three-dimensional structure of the apo form of the n-terminal egf-like module of blood coagulation factor x as determined by nmr spectroscopy and simulated folding
Class: coagulation factor
Keywords: coagulation factor
Deposited on 1992-04-21, released 1994-01-31
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: egf-like module of blood coagulation factor x
  Species: Bos taurus [TaxId:9913]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P00743 (0-41)
  Domains in SCOPe 2.04: d1apoa_
• Heterogens: OH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1apoA (A:)
  kdgdqceghpclnqghckdgigdytctcaegfegkncefstr