PDB entry 1apl
View 1apl on RCSB PDB site
Description: crystal structure of a mat-alpha2 homeodomain-operator complex suggests a general model for homeodomain-DNA interactions
Class: DNA binding protein/DNA
Keywords: protein-DNA complex, double helix, DNA binding protein/DNA complex
Deposited on
1993-10-04, released
1993-10-21
The last revision prior to the SCOPe 2.08 freeze date was dated
2009-02-24, with a file datestamp of
2009-02-03.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.226
AEROSPACI score: 0.22
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: DNA (5'-d(*ap*cp*ap*tp*gp*tp*ap*ap*tp*tp*cp*ap*tp*tp*tp*ap*c p*ap*cp*gp*c)-3')
- Chain 'B':
Compound: DNA (5'-d(*tp*gp*cp*gp*tp*gp*tp*ap*ap*ap*tp*gp*ap*ap*tp*tp*a p*cp*ap*tp*g)-3')
- Chain 'C':
Compound: protein (mat-alpha2 homeodomain)
Species: Saccharomyces cerevisiae [TaxId:4932]
Gene: MAT ALPHA2 RES. 128-210
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.08: d1aplc_ - Chain 'D':
Compound: protein (mat-alpha2 homeodomain)
Species: Saccharomyces cerevisiae [TaxId:4932]
Gene: MAT ALPHA2 RES. 128-210
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.08: d1apld_
PDB Chain Sequences:
- Chain 'A':
No sequence available.
- Chain 'B':
No sequence available.
- Chain 'C':
Sequence, based on SEQRES records: (download)
>1aplC (C:)
tkpyrghrftkenvrileswfaknienpyldtkglenlmkntslsriqiknwvsnrrrke
ktitiapeladllsgeplakkke
Sequence, based on observed residues (ATOM records): (download)
>1aplC (C:)
yrghrftkenvrileswfaknienpyldtkglenlmkntslsriqiknwvsnrrrkekt
- Chain 'D':
Sequence, based on SEQRES records: (download)
>1aplD (D:)
tkpyrghrftkenvrileswfaknienpyldtkglenlmkntslsriqiknwvsnrrrke
ktitiapeladllsgeplakkke
Sequence, based on observed residues (ATOM records): (download)
>1aplD (D:)
rghrftkenvrileswfaknienpyldtkglenlmkntslsriqiknwvsnrrrkekt