PDB entry 1apl

View 1apl on RCSB PDB site
Description: crystal structure of a mat-alpha2 homeodomain-operator complex suggests a general model for homeodomain-DNA interactions
Class: DNA binding protein/DNA
Keywords: protein-DNA complex, double helix, DNA binding protein/DNA complex
Deposited on 1993-10-04, released 1993-10-21
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.226
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: DNA (5'-d(*ap*cp*ap*tp*gp*tp*ap*ap*tp*tp*cp*ap*tp*tp*tp*ap*c p*ap*cp*gp*c)-3')
  • Chain 'B':
    Compound: DNA (5'-d(*tp*gp*cp*gp*tp*gp*tp*ap*ap*ap*tp*gp*ap*ap*tp*tp*a p*cp*ap*tp*g)-3')
  • Chain 'C':
    Compound: protein (mat-alpha2 homeodomain)
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: MAT ALPHA2 RES. 128-210
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1aplc_
  • Chain 'D':
    Compound: protein (mat-alpha2 homeodomain)
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: MAT ALPHA2 RES. 128-210
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1apld_

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1aplC (C:)
    tkpyrghrftkenvrileswfaknienpyldtkglenlmkntslsriqiknwvsnrrrke
    ktitiapeladllsgeplakkke
    

    Sequence, based on observed residues (ATOM records): (download)
    >1aplC (C:)
    yrghrftkenvrileswfaknienpyldtkglenlmkntslsriqiknwvsnrrrkekt
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1aplD (D:)
    tkpyrghrftkenvrileswfaknienpyldtkglenlmkntslsriqiknwvsnrrrke
    ktitiapeladllsgeplakkke
    

    Sequence, based on observed residues (ATOM records): (download)
    >1aplD (D:)
    rghrftkenvrileswfaknienpyldtkglenlmkntslsriqiknwvsnrrrkekt