PDB entry 1apj

View 1apj on RCSB PDB site
Description: nmr study of the transforming growth factor beta binding protein-like domain (tb module/8-cys domain), nmr, 21 structures
Class: extracellular matrix
Keywords: fibrillin fragment, microfibril, tb module, marfan syndrome, connective tissue, novel fold, extracellular matrix
Deposited on 1997-07-22, released 1998-01-28
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: fibrillin
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P35555 (0-73)
    • engineered (0-1)
  Domains in SCOPe 2.08: d1apja_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1apjA (A:)
  saqdlrmsycyakfeggkcsspksrnhskqecccalkgegwgdpcelcptepdeafrqic
  pygsgiivgpddsa