PDB entry 1aph

View 1aph on RCSB PDB site
Description: conformational changes in cubic insulin crystals in the ph range 7-11
Class: hormone
Keywords: hormone
Deposited on 1992-10-30, released 1993-01-15
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-11-29, with a file datestamp of 2017-11-24.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: insulin a chain (ph 7)
  Species: Bos taurus [TaxId:9913]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P01317 (0-20)
  Domains in SCOPe 2.08: d1aph.1
• Chain 'B':
  Compound: insulin b chain (ph 7)
  Species: Bos taurus [TaxId:9913]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P01317 (0-29)
  Domains in SCOPe 2.08: d1aph.1
• Heterogens: DCE, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1aphA (A:)
  giveqccasvcslyqlenycn
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1aphB (B:)
  fvnqhlcgshlvealylvcgergffytpka