PDB entry 1apf

View 1apf on RCSB PDB site
Description: anthopleurin-b, nmr, 20 structures
Class: cardiac stimulant
Keywords: toxin, sea anemone, cardiac stimulant
Deposited on 1995-05-30, released 1996-07-11
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-11-29, with a file datestamp of 2017-11-24.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: anthopleurin-b
  Species: Anthopleura xanthogrammica [TaxId:6112]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P01531 (0-48)
  Domains in SCOPe 2.08: d1apfa_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1apfA (A:)
  gvpclcdsdgprprgntlsgilwfypsgcpsgwhnckahgpnigwcckk