PDB entry 1ap8

View 1ap8 on RCSB PDB site
Description: translation initiation factor eif4e in complex with m7gdp, nmr, 20 structures
Class: RNA cap
Keywords: RNA cap, translation initiation factor
Deposited on 1997-07-25, released 1998-01-28
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: -0 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: translation initiation factor eif4e
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ap8a_
  • Heterogens: M7G

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1ap8A (A:)
msveevskkfeenvsvddttatpktvlsdsahfdvkhplntkwtlwytkpavdkseswsd
llrpvtsfqtveefwaiiqnipephelplksdyhvfrndvrpewedeanakggkwsfqlr
gkgadidelwlrtllavigetideddsqingvvlsirkggnkfalwtksedkepllrigg
kfkqvlkltddghleffphssangrhpqpsitl