PDB entry 1ap8

View 1ap8 on RCSB PDB site
Description: translation initiation factor eif4e in complex with m7gdp, nmr, 20 structures
Deposited on 1997-07-25, released 1998-01-28
The last revision prior to the SCOP 1.57 freeze date was dated 1998-01-28, with a file datestamp of 1998-01-28.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: -0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.57: d1ap8__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ap8_ (-)
    msveevskkfeenvsvddttatpktvlsdsahfdvkhplntkwtlwytkpavdkseswsd
    llrpvtsfqtveefwaiiqnipephelplksdyhvfrndvrpewedeanakggkwsfqlr
    gkgadidelwlrtllavigetideddsqingvvlsirkggnkfalwtksedkepllrigg
    kfkqvlkltddghleffphssangrhpqpsitl