PDB entry 1ap7

View 1ap7 on RCSB PDB site
Description: p19-ink4d from mouse, nmr, 20 structures
Class: cell cycle inhibitor
Keywords: cell cycle inhibitor, cyclin dependent kinase inhibitor, ink, cdki, ankyrin repeat
Deposited on 1997-07-25, released 1998-09-16
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: p19-ink4d
  Species: Mus musculus [TaxId:10090]
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q60773 (2-167)
    • conflict (17)
  Domains in SCOPe 2.08: d1ap7a_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1ap7A (A:)
  gsmlleevcvgdrlsgaaargdvqevrrllhrelvhpdalnrfgktalqvmmfgspaval
  ellkqgaspnvqdasgtspvhdaartgfldtlkvlvehgadvnaldstgslpihlaireg
  hssvvsflapesdlhhrdasgltplelarqrgaqnlmdilqghmmipm