PDB entry 1ap5

View 1ap5 on RCSB PDB site
Description: tyr34->phe mutant of human mitochondrial manganese superoxide dismutase
Class: oxidoreductase
Keywords: oxidoreductase, manganese, transit peptide
Deposited on 1997-07-24, released 1998-01-28
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-29, with a file datestamp of 2017-11-24.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: N/A
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: manganese superoxide dismutase
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P04179 (0-197)
      • engineered (33)
    Domains in SCOPe 2.07: d1ap5a1, d1ap5a2
  • Chain 'B':
    Compound: manganese superoxide dismutase
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P04179 (0-197)
      • engineered (33)
    Domains in SCOPe 2.07: d1ap5b1, d1ap5b2
  • Heterogens: MN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ap5A (A:)
    khslpdlpydygalephinaqimqlhhskhhaafvnnlnvteekyqealakgdvtaqial
    qpalkfnggghinhsifwtnlspngggepkgelleaikrdfgsfdkfkekltaasvgvqg
    sgwgwlgfnkerghlqiaacpnqdplqgttglipllgidvwehayylqyknvrpdylkai
    wnvinwenvterymackk
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ap5B (B:)
    khslpdlpydygalephinaqimqlhhskhhaafvnnlnvteekyqealakgdvtaqial
    qpalkfnggghinhsifwtnlspngggepkgelleaikrdfgsfdkfkekltaasvgvqg
    sgwgwlgfnkerghlqiaacpnqdplqgttglipllgidvwehayylqyknvrpdylkai
    wnvinwenvterymackk