PDB entry 1ap4

View 1ap4 on RCSB PDB site
Description: regulatory domain of human cardiac troponin c in the calcium-saturated state, nmr, 40 structures
Class: calcium-binding
Keywords: calcium-binding, regulation, troponin c, cardiac muscle contraction
Deposited on 1997-07-24, released 1998-07-15
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cardiac n-troponin c
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1ap4a_
  • Heterogens: CA

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ap4A (A:)
    mddiykaaveqlteeqknefkaafdifvlgaedgcistkelgkvmrmlgqnptpeelqem
    idevdedgsgtvdfdeflvmmvrcmkdds