PDB entry 1ap2

View 1ap2 on RCSB PDB site
Description: single chain fv of c219
Class: immunoglobulin
Keywords: single chain fv, monoclonal antibody, c219, p-glycoprotein, immunoglobulin
Deposited on 1997-07-23, released 1997-12-24
The last revision prior to the SCOP 1.73 freeze date was dated 1997-12-24, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.2045
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: monoclonal antibody c219
    Species: MUS MUSCULUS
    Gene: CDNA
    Database cross-references and differences (RAF-indexed):
    • GB AAA38735 (0-110)
    Domains in SCOP 1.73: d1ap2a_
  • Chain 'B':
    Compound: monoclonal antibody c219
    Species: MUS MUSCULUS
    Gene: CDNA
    Database cross-references and differences (RAF-indexed):
    • EMBL CAA80052 (0-End)
      • conflict (32)
      • conflict (55)
      • conflict (70)
      • insertion (99-100)
      • conflict (101-102)
      • insertion (105)
      • conflict (106-107)
      • conflict (109)
      • conflict (112)
      • conflict (115)
      • conflict (119)
    Domains in SCOP 1.73: d1ap2b_
  • Chain 'C':
    Compound: monoclonal antibody c219
    Species: MUS MUSCULUS
    Gene: CDNA
    Database cross-references and differences (RAF-indexed):
    • GB AAA38735 (0-110)
    Domains in SCOP 1.73: d1ap2c_
  • Chain 'D':
    Compound: monoclonal antibody c219
    Species: MUS MUSCULUS
    Gene: CDNA
    Database cross-references and differences (RAF-indexed):
    • EMBL CAA80052 (0-120)
      • conflict (32)
      • conflict (55)
      • conflict (70)
      • insertion (99-100)
      • conflict (101-102)
      • insertion (105)
      • conflict (106-107)
      • conflict (109)
      • conflict (112)
      • conflict (115)
      • conflict (119)
    Domains in SCOP 1.73: d1ap2d_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ap2A (A:)
    divmtqspssltvtagekvtmsckssqsllnsgnqknyltwyqqkpgqppklliywastr
    esgvpdrftgsgsgtdftltissvqaedlavyycqndysypltfgagtklepg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ap2A (A:)
    divmtqspssltvtagekvtmsckssqsllnsgnqknyltwyqqkpgqppklliywastr
    esgvpdrftgsgsgtdftltissvqaedlavyycqndysypltfgagtklep
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1ap2B (B:)
    evqlqqsgaelvrpgasvklsctasgfnikddfmhwvkqrpeqglewigridpandntky
    apkfqdkatiiadtssntaylqlssltsedtavyycarrevysyyspldvwgagttvtvp
    sgs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ap2B (B:)
    evqlqqsgaelvrpgasvklsctasgfnikddfmhwvkqrpeqglewigridpandntky
    apkfqdkatiiadtssntaylqlssltsedtavyycarrevysyyspldvwgagttvtvp
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ap2C (C:)
    divmtqspssltvtagekvtmsckssqsllnsgnqknyltwyqqkpgqppklliywastr
    esgvpdrftgsgsgtdftltissvqaedlavyycqndysypltfgagtklepg
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ap2D (D:)
    evqlqqsgaelvrpgasvklsctasgfnikddfmhwvkqrpeqglewigridpandntky
    apkfqdkatiiadtssntaylqlssltsedtavyycarrevysyyspldvwgagttvtvp
    sgs