PDB entry 1ap0

View 1ap0 on RCSB PDB site
Description: structure of the chromatin binding (chromo) domain from mouse modifier protein 1, nmr, 26 structures
Deposited on 1997-07-22, released 1998-07-22
The last revision prior to the SCOP 1.55 freeze date was dated 1998-07-22, with a file datestamp of 1998-07-22.
Experiment type: NMR26
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.55: d1ap0__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ap0_ (-)
    hmveevleeeeeeyvvekvldrrvvkgkveyllkwkgfsdedntwepeenldcpdliaef
    lqsqktahetdks