PDB entry 1ap0

View 1ap0 on RCSB PDB site
Description: structure of the chromatin binding (chromo) domain from mouse modifier protein 1, nmr, 26 structures
Class: chromatin-binding
Keywords: chromatin-binding, protein interaction motif, alpha+beta
Deposited on 1997-07-22, released 1998-07-22
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: modifier protein 1
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1ap0a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ap0A (A:)
    hmveevleeeeeeyvvekvldrrvvkgkveyllkwkgfsdedntwepeenldcpdliaef
    lqsqktahetdks