PDB entry 1aoz

View 1aoz on RCSB PDB site
Description: refined crystal structure of ascorbate oxidase at 1.9 angstroms resolution
Class: oxidoreductase(oxygen acceptor)
Keywords: oxidoreductase(oxygen acceptor)
Deposited on 1992-01-08, released 1993-10-31
The last revision prior to the SCOP 1.75 freeze date was dated 2003-04-01, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: N/A
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ascorbate oxidase
    Species: Cucurbita pepo var. melopepo
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1aoza1, d1aoza2, d1aoza3
  • Chain 'B':
    Compound: ascorbate oxidase
    Species: Cucurbita pepo var. melopepo
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1aozb1, d1aozb2, d1aozb3
  • Heterogens: NAG, CU, C2O, C1O, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1aozA (A:)
    sqirhykweveymfwapncnenivmgingqfpgptiranagdsvvveltnklhtegvvih
    whgilqrgtpwadgtasisqcainpgetffynftvdnpgtffyhghlgmqrsaglygsli
    vdppqgkkepfhydgeinlllsdwwhqsihkqevglsskpirwigepqtillngrgqfdc
    siaakydsnlepcklkgsescapyifhvspkktyririasttalaalnfaignhqllvve
    adgnyvqpfytsdidiysgesysvlittdqnpsenywvsvgtrarhpntppgltllnylp
    nsvsklptspppqtpawddfdrsknftyritaamgspkppvkfnrrifllntqnvingyv
    kwaindvslalpptpylgamkynllhafdqnpppevfpedydidtpptnektrigngvyq
    fkigevvdvilqnanmmkenlsethpwhlhghdfwvlgygdgkfsaeeesslnlknpplr
    ntvvifpygwtairfvadnpgvwafhchiephlhmgmgvvfaegvekvgriptkalacgg
    takslinnpknp
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1aozB (B:)
    sqirhykweveymfwapncnenivmgingqfpgptiranagdsvvveltnklhtegvvih
    whgilqrgtpwadgtasisqcainpgetffynftvdnpgtffyhghlgmqrsaglygsli
    vdppqgkkepfhydgeinlllsdwwhqsihkqevglsskpirwigepqtillngrgqfdc
    siaakydsnlepcklkgsescapyifhvspkktyririasttalaalnfaignhqllvve
    adgnyvqpfytsdidiysgesysvlittdqnpsenywvsvgtrarhpntppgltllnylp
    nsvsklptspppqtpawddfdrsknftyritaamgspkppvkfnrrifllntqnvingyv
    kwaindvslalpptpylgamkynllhafdqnpppevfpedydidtpptnektrigngvyq
    fkigevvdvilqnanmmkenlsethpwhlhghdfwvlgygdgkfsaeeesslnlknpplr
    ntvvifpygwtairfvadnpgvwafhchiephlhmgmgvvfaegvekvgriptkalacgg
    takslinnpknp