PDB entry 1aoy

View 1aoy on RCSB PDB site
Description: n-terminal domain of escherichia coli arginine repressor nmr, 23 structures
Class: DNA-binding protein
Keywords: DNA-binding protein, expression regulation, DNA organization, winged helix
Deposited on 1997-07-14, released 1997-09-17
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Arginine repressor
  Species: Escherichia coli [TaxId:83333]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P0A6D0 (0-77)
  Domains in SCOPe 2.08: d1aoya_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1aoyA (A:)
  mrssakqeelvkafkallkeekfssqgeivaalqeqgfdninqskvsrmltkfgavrtrn
  akmemvyclpaelgvptt