PDB entry 1aox

View 1aox on RCSB PDB site
Description: i domain from integrin alpha2-beta1
Deposited on 1997-07-13, released 1998-11-25
The last revision prior to the SCOP 1.67 freeze date was dated 1998-11-25, with a file datestamp of 1998-11-25.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.219
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.67: d1aoxa_
  • Chain 'B':
    Domains in SCOP 1.67: d1aoxb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1aoxA (A:)
    rsscpslidvvvvcdesnsiypwdavknflekfvqgldigptktqvgliqyannprvvfn
    lntyktkeemivatsqtsqyggdltntfgaiqyarkyaysaasggrrsatkvmvvvtdge
    shdgsmlkavidqcnhdnilrfgiavlgylnrnaldtknlikeikaiasipteryffnvs
    deaallekagtlgeqifsieggt
    

    Sequence, based on observed residues (ATOM records): (download)
    >1aoxA (A:)
    scpslidvvvvcdesnsiypwdavknflekfvqgldigptktqvgliqyannprvvfnln
    tyktkeemivatsqtsqyggdltntfgaiqyarkyaysaasggrrsatkvmvvvtdgesh
    dgsmlkavidqcnhdnilrfgiavlgylnrnaldtknlikeikaiasipteryffnvsde
    aallekagtlgeqifsieggt
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1aoxB (B:)
    rsscpslidvvvvcdesnsiypwdavknflekfvqgldigptktqvgliqyannprvvfn
    lntyktkeemivatsqtsqyggdltntfgaiqyarkyaysaasggrrsatkvmvvvtdge
    shdgsmlkavidqcnhdnilrfgiavlgylnrnaldtknlikeikaiasipteryffnvs
    deaallekagtlgeqifsieggt
    

    Sequence, based on observed residues (ATOM records): (download)
    >1aoxB (B:)
    rsscpslidvvvvcdesnsiypwdavknflekfvqgldigptktqvgliqyannprvvfn
    lntyktkeemivatsqtsqyggdltntfgaiqyarkyaysaasggrrsatkvmvvvtdge
    shdgsmlkavidqcnhdnilrfgiavlgylnrnaldtknlikeikaiasipteryffnvs
    deaallekagtlgeqifsieg