PDB entry 1aox

View 1aox on RCSB PDB site
Description: I domain from integrin alpha2-beta1
Class: integrin
Keywords: integrin, cell adhesion, glycoprotein
Deposited on 1997-07-13, released 1998-11-25
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.219
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: integrin alpha 2 beta
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P17301 (Start-202)
      • insertion (200)
    Domains in SCOPe 2.07: d1aoxa_
  • Chain 'B':
    Compound: integrin alpha 2 beta
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P17301 (1-End)
      • insertion (200)
    Domains in SCOPe 2.07: d1aoxb_
  • Heterogens: MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1aoxA (A:)
    rsscpslidvvvvcdesnsiypwdavknflekfvqgldigptktqvgliqyannprvvfn
    lntyktkeemivatsqtsqyggdltntfgaiqyarkyaysaasggrrsatkvmvvvtdge
    shdgsmlkavidqcnhdnilrfgiavlgylnrnaldtknlikeikaiasipteryffnvs
    deaallekagtlgeqifsieggt
    

    Sequence, based on observed residues (ATOM records): (download)
    >1aoxA (A:)
    scpslidvvvvcdesnsiypwdavknflekfvqgldigptktqvgliqyannprvvfnln
    tyktkeemivatsqtsqyggdltntfgaiqyarkyaysaasggrrsatkvmvvvtdgesh
    dgsmlkavidqcnhdnilrfgiavlgylnrnaldtknlikeikaiasipteryffnvsde
    aallekagtlgeqifsieggt
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1aoxB (B:)
    rsscpslidvvvvcdesnsiypwdavknflekfvqgldigptktqvgliqyannprvvfn
    lntyktkeemivatsqtsqyggdltntfgaiqyarkyaysaasggrrsatkvmvvvtdge
    shdgsmlkavidqcnhdnilrfgiavlgylnrnaldtknlikeikaiasipteryffnvs
    deaallekagtlgeqifsieggt
    

    Sequence, based on observed residues (ATOM records): (download)
    >1aoxB (B:)
    rsscpslidvvvvcdesnsiypwdavknflekfvqgldigptktqvgliqyannprvvfn
    lntyktkeemivatsqtsqyggdltntfgaiqyarkyaysaasggrrsatkvmvvvtdge
    shdgsmlkavidqcnhdnilrfgiavlgylnrnaldtknlikeikaiasipteryffnvs
    deaallekagtlgeqifsieg