PDB entry 1aow

View 1aow on RCSB PDB site
Description: annexin IV
Class: calcium/phospholipid-binding protein
Keywords: calcium/phospholipid-binding protein, 32.5kd calelectrin, endonexin I, lipocortin IV, chromobindin IV, protein II
Deposited on 1997-07-11, released 1998-01-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.19
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: annexin IV
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P13214 (0-308)
      • conflict (84)
    Domains in SCOPe 2.07: d1aowa_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1aowA (A:)
    asgfnaaedaqtlrkamkglgtdedaiinvlayrstaqrqeirtaykttigrdlmddlks
    elsgnfeqvilgmmtptvlydvqevrkamkgagtdegclieilasrtpeeirrinqtyql
    qygrsleddirsdtsfmfqrvlvslsaggrdesnylddalmrqdaqdlyeagekkwgtde
    vkfltvlcsrnrnhllhvfdeykriaqkdieqsiksetsgsfedallaivkcmrnksayf
    aerlyksmkglgtdddtlirvmvsraeidmldiranfkrlygkslysfikgdtsgdyrkv
    llilcggdd