PDB entry 1aov

View 1aov on RCSB PDB site
Description: apo duck ovotransferrin
Deposited on 1996-12-11, released 1997-06-16
The last revision prior to the SCOP 1.55 freeze date was dated 1997-06-16, with a file datestamp of 1997-06-17.
Experiment type: XRAY
Resolution: 4 Å
R-factor: 0.21
AEROSPACI score: 0.13 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1aov_ (-)
    appkttvrwctissaeekkcnslkdhmqqervtlscvqkatyldcikaisnneadaisld
    ggqvfeaglapyklkpiaaevyersggsttsyyavavvkkgtdfmikdlrgktschtglg
    rsagwnipigtlihrediewegiesgiseqavakffsascvpgatieqklcrqckgdakt
    kclrngpysgysgafqclkdgkgdvafvkhttvqenapeekdeyellcldgsrqpvdsyk
    tcnwarvaahavvarddskiddiwsflgmqayslgvdttsdfhlfgppgkkdpvlkdllf
    kdsaimlkrvpelmdsqlylgfeyysaiqslrkdqltvgprenkiqwcavgkdekskcdr
    wsvvsngevectilddnkdcivkitkgeadaisldggfvytagvcglvpvvgesyedetq
    cskdeeqpayyfavavvkkssaitwnnlqgkkschtavgrtagwnipmglihnktgscdf
    ddyfsegcapgsppnsrlcklcqgsgenllekcvasshekyygytgalrclveqgdvafi
    khstvgenvsgsnkddwakgltrddfellctngkraktmdyktchlakvpthavvarpek
    ankirellegqeklfglhgtekerfmmfqsqtkdllfkaltkclvklrqgitykeflgde
    yyasvaslntcnpsdllqvctfledk