PDB entry 1aov

View 1aov on RCSB PDB site
Description: apo duck ovotransferrin
Class: transferrin
Keywords: transferrin, iron uptake, protein crystallography, molecular replacement
Deposited on 1996-12-11, released 1997-06-16
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 4 Å
R-factor: 0.21
AEROSPACI score: 0.11 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: apo-ovotransferrin
    Species: Anas platyrhynchos [TaxId:8839]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1aova1, d1aova2

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1aovA (A:)
    appkttvrwctissaeekkcnslkdhmqqervtlscvqkatyldcikaisnneadaisld
    ggqvfeaglapyklkpiaaevyersggsttsyyavavvkkgtdfmikdlrgktschtglg
    rsagwnipigtlihrediewegiesgiseqavakffsascvpgatieqklcrqckgdakt
    kclrngpysgysgafqclkdgkgdvafvkhttvqenapeekdeyellcldgsrqpvdsyk
    tcnwarvaahavvarddskiddiwsflgmqayslgvdttsdfhlfgppgkkdpvlkdllf
    kdsaimlkrvpelmdsqlylgfeyysaiqslrkdqltvgprenkiqwcavgkdekskcdr
    wsvvsngevectilddnkdcivkitkgeadaisldggfvytagvcglvpvvgesyedetq
    cskdeeqpayyfavavvkkssaitwnnlqgkkschtavgrtagwnipmglihnktgscdf
    ddyfsegcapgsppnsrlcklcqgsgenllekcvasshekyygytgalrclveqgdvafi
    khstvgenvsgsnkddwakgltrddfellctngkraktmdyktchlakvpthavvarpek
    ankirellegqeklfglhgtekerfmmfqsqtkdllfkaltkclvklrqgitykeflgde
    yyasvaslntcnpsdllqvctfledk