PDB entry 1aou

View 1aou on RCSB PDB site
Description: nmr structure of the fyn sh2 domain complexed with a phosphotyrosyl peptide, 22 structures
Class: complex (proto-oncogene/early protein)
Keywords: sh2 domain, signal transduction, peptide complex, complex (proto-oncogene/early protein)
Deposited on 1997-07-10, released 1998-01-14
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'F':
  Compound: fyn protein-tyrosine kinase
  Species: Homo sapiens [TaxId:9606]
  Gene: LYSS
  Database cross-references and differences (RAF-indexed):
  • Uniprot P06241 (0-105)
    • engineered (96-97)
    • engineered (103)
  Domains in SCOPe 2.08: d1aouf_
• Chain 'P':
  Compound: phosphotyrosyl peptide
  Species: Hamster polyomavirus [TaxId:10626]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P03079 (0-10)

PDB Chain Sequences:

• Chain 'F':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1aouF (F:)
  siqaeewyfgklgrkdaerqllsfgnprgtfliresettkgayslsirdwddmkgdhvkh
  ykirkldnggyyittraqfetlqqlvqhyseraaglssrlvvpshk
  

  
  
• Chain 'P':
  No sequence available.