PDB entry 1aot

View 1aot on RCSB PDB site
Description: nmr structure of the fyn sh2 domain complexed with a phosphotyrosyl peptide, minimized average structure
Class: complex (proto-oncogene/early protein)
Keywords: sh2 domain, signal transduction, peptide complex, complex (proto-oncogene/early protein)
Deposited on 1997-07-10, released 1998-01-14
The last revision prior to the SCOP 1.73 freeze date was dated 1998-01-14, with a file datestamp of 2007-06-28.
Experiment type: NMRAVE
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'F':
  Compound: fyn protein-tyrosine kinase
  Species: HOMO SAPIENS
  Gene: LYSS
  Database cross-references and differences (RAF-indexed):
  • Uniprot P06241 (0-105)
    • engineered (96-97)
    • engineered (103)
  Domains in SCOP 1.73: d1aotf_
• Chain 'P':
  Compound: phosphotyrosyl peptide
  Species: Hamster polyomavirus
  Database cross-references and differences (RAF-indexed):
  • Uniprot P03079 (0-10)

PDB Chain Sequences:

• Chain 'F':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1aotF (F:)
  siqaeewyfgklgrkdaerqllsfgnprgtfliresettkgayslsirdwddmkgdhvkh
  ykirkldnggyyittraqfetlqqlvqhyseraaglssrlvvpshk
  

  
  
• Chain 'P':
  No sequence available.