PDB entry 1aot

View 1aot on RCSB PDB site
Description: nmr structure of the fyn sh2 domain complexed with a phosphotyrosyl peptide, minimized average structure
Deposited on 1997-07-10, released 1998-01-14
The last revision prior to the SCOP 1.55 freeze date was dated 1998-01-14, with a file datestamp of 1998-01-14.
Experiment type: NMRAVE
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'F':
  Domains in SCOP 1.55: d1aotf_

PDB Chain Sequences:

• Chain 'F':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1aotF (F:)
  siqaeewyfgklgrkdaerqllsfgnprgtfliresettkgayslsirdwddmkgdhvkh
  ykirkldnggyyittraqfetlqqlvqhyseraaglssrlvvpshk