PDB entry 1aot

View 1aot on RCSB PDB site
Description: nmr structure of the fyn sh2 domain complexed with a phosphotyrosyl peptide, minimized average structure
Class: complex (proto-oncogene/early protein)
Keywords: sh2 domain, signal transduction, peptide complex, complex (proto-oncogene/early protein)
Deposited on 1997-07-10, released 1998-01-14
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'F':
    Compound: fyn protein-tyrosine kinase
    Species: Homo sapiens [TaxId:9606]
    Gene: LYSS
    Database cross-references and differences (RAF-indexed):
    • Uniprot P06241 (0-105)
      • engineered (96-97)
      • engineered (103)
    Domains in SCOPe 2.08: d1aotf_
  • Chain 'P':
    Compound: phosphotyrosyl peptide
    Species: Hamster polyomavirus [TaxId:10626]
    Database cross-references and differences (RAF-indexed):

PDB Chain Sequences:

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1aotF (F:)
    siqaeewyfgklgrkdaerqllsfgnprgtfliresettkgayslsirdwddmkgdhvkh
    ykirkldnggyyittraqfetlqqlvqhyseraaglssrlvvpshk
    

  • Chain 'P':
    No sequence available.