PDB entry 1aos

View 1aos on RCSB PDB site
Description: human argininosuccinate lyase
Deposited on 1997-07-10, released 1998-01-14
The last revision prior to the SCOP 1.59 freeze date was dated 1998-01-14, with a file datestamp of 1998-01-14.
Experiment type: XRAY
Resolution: 4.2 Å
R-factor: 0.1879
AEROSPACI score: 0.14 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.59: d1aosa_
  • Chain 'B':
    Domains in SCOP 1.59: d1aosb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1aosA (A:)
    imekfnasiaydrhlwevdvqgskaysrglekaglltkaemdqilhgldkvaeewaqgtf
    klnsndedihtanerrlkeligatagklhtgrsrndqvvtdlrlwmrqtcstlsgllwel
    irtmvdraeaerdvlfpgythlqraqpirwshwilshavaltrdserllevrkrinvlpl
    gsgaiagnplgvdrellraelnfgaitlnsmdatserdfvaeflfwrslcmthlsrmaed
    lilyctkefsfvqlsdaystgsslmpqkknpdslelirskagrvfgrcagllmtlkglps
    tynkdlqedkeavfevsdtmsavlqvatgvistlqihqenmgqalspdmlatdlayylvr
    kgmpfrqaheasgkavfmaetkgvalnqlslqelqtisplfsgdvicvwdyrhsveqyga
    lggtarssvdwqirqvrallqaq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1aosA (A:)
    imekfnasiaydrhlwevdvqgskaysrglekaglltkaemdqilhgldkvklnsndedi
    htanerrlkeligatagklhtgrsrndqvvtdlrlwmrqtcstlsgllwelirtmvdrae
    aerdvlfpgythlqraqpirwshwilshavaltrdserllevrkrinvlplgsgaiagnp
    lgvdrellraelnfgaitlnsmdatserdfvaeflfwrslcmthlsrmaedlilyctkef
    sfvqlsdaystgsslmpqkknpdslelirskagrvfgrcagllmtlkglpstynkdlqed
    keavfevsdtmsavlqvatgvistlqihqenmgqalspdmlatdlayylvrkgmpfrqah
    easgkavfmaetkgvalnqlslqelqtisplfsgdvicvwdyrhsveqygalggtarssv
    dwqirqvrallqaq
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1aosB (B:)
    imekfnasiaydrhlwevdvqgskaysrglekaglltkaemdqilhgldkvaeewaqgtf
    klnsndedihtanerrlkeligatagklhtgrsrndqvvtdlrlwmrqtcstlsgllwel
    irtmvdraeaerdvlfpgythlqraqpirwshwilshavaltrdserllevrkrinvlpl
    gsgaiagnplgvdrellraelnfgaitlnsmdatserdfvaeflfwrslcmthlsrmaed
    lilyctkefsfvqlsdaystgsslmpqkknpdslelirskagrvfgrcagllmtlkglps
    tynkdlqedkeavfevsdtmsavlqvatgvistlqihqenmgqalspdmlatdlayylvr
    kgmpfrqaheasgkavfmaetkgvalnqlslqelqtisplfsgdvicvwdyrhsveqyga
    lggtarssvdwqirqvrallqaq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1aosB (B:)
    imekfnasiaydrhlwevdvqgskaysrglekaglltkaemdqilhgldkvklnsndedi
    htanerrlkeligatagklhtgrsrndqvvtdlrlwmrqtcstlsgllwelirtmvdrae
    aerdvlfpgythlqraqpirwshwilshavaltrdserllevrkrinvlplgsgaiagnp
    lgvdrellraelnfgaitlnsmdatserdfvaeflfwrslcmthlsrmaedlilyctkef
    sfvqlsdaystgsslmpqkknpdslelirskagrvfgrcagllmtlkglpstynkdlqed
    keavfevsdtmsavlqvatgvistlqihqenmgqalspdmlatdlayylvrkgmpfrqah
    easgkavfmaetkgvalnqlslqelqtisplfsgdvicvwdyrhsveqygalggtarssv
    dwqirqvrallqaq