PDB entry 1aos

View 1aos on RCSB PDB site
Description: human argininosuccinate lyase
Class: lyase
Keywords: arginine biosynthesis, lyase, urea cycle
Deposited on 1997-07-10, released 1998-01-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 4.2 Å
R-factor: 0.188
AEROSPACI score: 0.14 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Argininosuccinate Lyase
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1aosa_
  • Chain 'B':
    Compound: Argininosuccinate Lyase
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1aosb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1aosA (A:)
    masesqklwggrfvgavdpimekfnasiaydrhlwevdvqgskaysrglekaglltkaem
    dqilhgldkvaeewaqgtfklnsndedihtanerrlkeligatagklhtgrsrndqvvtd
    lrlwmrqtcstlsgllwelirtmvdraeaerdvlfpgythlqraqpirwshwilshaval
    trdserllevrkrinvlplgsgaiagnplgvdrellraelnfgaitlnsmdatserdfva
    eflfwrslcmthlsrmaedlilyctkefsfvqlsdaystgsslmpqkknpdslelirska
    grvfgrcagllmtlkglpstynkdlqedkeavfevsdtmsavlqvatgvistlqihqenm
    gqalspdmlatdlayylvrkgmpfrqaheasgkavfmaetkgvalnqlslqelqtisplf
    sgdvicvwdyrhsveqygalggtarssvdwqirqvrallqaqqa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1aosA (A:)
    imekfnasiaydrhlwevdvqgskaysrglekaglltkaemdqilhgldkvklnsndedi
    htanerrlkeligatagklhtgrsrndqvvtdlrlwmrqtcstlsgllwelirtmvdrae
    aerdvlfpgythlqraqpirwshwilshavaltrdserllevrkrinvlplgsgaiagnp
    lgvdrellraelnfgaitlnsmdatserdfvaeflfwrslcmthlsrmaedlilyctkef
    sfvqlsdaystgsslmpqkknpdslelirskagrvfgrcagllmtlkglpstynkdlqed
    keavfevsdtmsavlqvatgvistlqihqenmgqalspdmlatdlayylvrkgmpfrqah
    easgkavfmaetkgvalnqlslqelqtisplfsgdvicvwdyrhsveqygalggtarssv
    dwqirqvrallqaq
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1aosB (B:)
    masesqklwggrfvgavdpimekfnasiaydrhlwevdvqgskaysrglekaglltkaem
    dqilhgldkvaeewaqgtfklnsndedihtanerrlkeligatagklhtgrsrndqvvtd
    lrlwmrqtcstlsgllwelirtmvdraeaerdvlfpgythlqraqpirwshwilshaval
    trdserllevrkrinvlplgsgaiagnplgvdrellraelnfgaitlnsmdatserdfva
    eflfwrslcmthlsrmaedlilyctkefsfvqlsdaystgsslmpqkknpdslelirska
    grvfgrcagllmtlkglpstynkdlqedkeavfevsdtmsavlqvatgvistlqihqenm
    gqalspdmlatdlayylvrkgmpfrqaheasgkavfmaetkgvalnqlslqelqtisplf
    sgdvicvwdyrhsveqygalggtarssvdwqirqvrallqaqqa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1aosB (B:)
    imekfnasiaydrhlwevdvqgskaysrglekaglltkaemdqilhgldkvklnsndedi
    htanerrlkeligatagklhtgrsrndqvvtdlrlwmrqtcstlsgllwelirtmvdrae
    aerdvlfpgythlqraqpirwshwilshavaltrdserllevrkrinvlplgsgaiagnp
    lgvdrellraelnfgaitlnsmdatserdfvaeflfwrslcmthlsrmaedlilyctkef
    sfvqlsdaystgsslmpqkknpdslelirskagrvfgrcagllmtlkglpstynkdlqed
    keavfevsdtmsavlqvatgvistlqihqenmgqalspdmlatdlayylvrkgmpfrqah
    easgkavfmaetkgvalnqlslqelqtisplfsgdvicvwdyrhsveqygalggtarssv
    dwqirqvrallqaq