PDB entry 1aor

View 1aor on RCSB PDB site
Description: structure of a hyperthermophilic tungstopterin enzyme, aldehyde ferredoxin oxidoreductase
Class: oxidoreductase
Keywords: oxidoreductase
Deposited on 1995-02-13, released 1995-04-20
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-03-24, with a file datestamp of 2009-03-20.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.155
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: aldehyde ferredoxin oxidoreductase
    Species: Pyrococcus furiosus [TaxId:2261]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1aora1, d1aora2
  • Chain 'B':
    Compound: aldehyde ferredoxin oxidoreductase
    Species: Pyrococcus furiosus [TaxId:2261]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1aorb1, d1aorb2
  • Heterogens: FE, NA, SF4, PTE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1aorA (A:)
    mygnwgrfirvnlstgdikveeydeelakkwlgsrglaiylllkemdptvdplspenkli
    iaagpltgtsaptggrynvvtkspltgfitmansggyfgaelkfagydaivvegkaekpv
    yiyikdehieirdashiwgkkvseteatirkevgsekvkiasigpagenlvkfaaimndg
    hraagrggvgavmgsknlkaiavegsktvpiadkqkfmlvvrekvnklrndpvaggglpk
    ygtavlvniinenglypvknfqtgvypyayeqsgeamaakylvrnkpcyacpigcgrvnr
    lptvgetegpeyesvwalganlgindlasiieanhmcdelgldtistggtlatamelyek
    ghikdeelgdappfrwgntevlhyyiekiakregfgdklaegsyrlaesyghpelsmtvk
    klelpaydprgaeghglgyatnnrggchiknymispeilgypykmdphdvsddkikmlil
    fqdltalidsaglclfttfglgaddyrdllnaalgwdfttedylkigeriwnaerlfnlk
    agldparddtlpkrfleepmpegpnkghtvrlkemlpryyklrgwtedgkipkekleelg
    iaefy
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1aorB (B:)
    mygnwgrfirvnlstgdikveeydeelakkwlgsrglaiylllkemdptvdplspenkli
    iaagpltgtsaptggrynvvtkspltgfitmansggyfgaelkfagydaivvegkaekpv
    yiyikdehieirdashiwgkkvseteatirkevgsekvkiasigpagenlvkfaaimndg
    hraagrggvgavmgsknlkaiavegsktvpiadkqkfmlvvrekvnklrndpvaggglpk
    ygtavlvniinenglypvknfqtgvypyayeqsgeamaakylvrnkpcyacpigcgrvnr
    lptvgetegpeyesvwalganlgindlasiieanhmcdelgldtistggtlatamelyek
    ghikdeelgdappfrwgntevlhyyiekiakregfgdklaegsyrlaesyghpelsmtvk
    klelpaydprgaeghglgyatnnrggchiknymispeilgypykmdphdvsddkikmlil
    fqdltalidsaglclfttfglgaddyrdllnaalgwdfttedylkigeriwnaerlfnlk
    agldparddtlpkrfleepmpegpnkghtvrlkemlpryyklrgwtedgkipkekleelg
    iaefy