PDB entry 1aop

View 1aop on RCSB PDB site
Description: sulfite reductase structure at 1.6 angstrom resolution
Deposited on 1997-07-08, released 1997-12-24
The last revision prior to the SCOP 1.55 freeze date was dated 1997-12-24, with a file datestamp of 1997-12-24.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.182
AEROSPACI score: 0.59 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain ' ':
    Sequence, based on SEQRES records: (download)
    >1aop_ (-)
    llrcrlpggvittkqwqaidkfagentiygsirltnrqtfqfhgilkknvkpvhqmlhsv
    gldalatandmnrnvlctsnpyesqlhaeayewakkisehllprtrayaeiwldqekvat
    tdeepilgqtylprkfkttvvippqndidlhandmnfvaiaengklvgfnllvggglsie
    hgnkktyartasefgylplehtlavaeavvttqrdwgnrtdrknaktkytlervgvetfk
    aeverragikfepirpyeftgrgdrigwvkgiddnwhltlfiengrildyparplktgll
    eiakihkgdfritanqnliiagvpesekakiekiakesglmnavtpqrensmacvsfptc
    plamaeaerflpsfidnidnlmakhgvsdehivmrvtgcpngcgramlaevglvgkapgr
    ynlhlggnrigtriprmykenitepeilasldeligrwakereagegfgdftvragiirp
    vldpardlwd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1aop_ (-)
    llrcrlpggvittkqwqaidkfagentiygsirltnrqtfqfhgilpvhqmlhsvgldal
    ndmnrnvlctsnpyesqlhaeayewakkisehllptylprkfkttvvippqndidlhand
    mnfvaiaengklvgfnllvggglsiehgnkktyartasefgylplehtlavaeavvttqr
    dwgnrtdrknaktkytlervgvetfkaeverragikfepirpyeftgrgdrigwvkgidd
    nwhltlfiengrildyparplktglleiakihkgdfritanqnliiagvpesekakieki
    akesglmnavtpqrensmacvsfptcplamaeaerflpsfidnidnlmakhgvsdehivm
    rvtgcpngcgramlaevglvgkapgrynlhlggnrigtriprmykenitepeilasldel
    igrwakereagegfgdftvragiirpvldpardlwd