PDB entry 1aom

View 1aom on RCSB PDB site
Description: substrate and product bound to cytochrome cd1 nitrite reductase
Class: oxidoreductase
Keywords: oxidoreductase, enzyme, nitrite reductase
Deposited on 1997-07-08, released 1998-02-04
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.181
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: nitrite reductase
    Species: Paracoccus pantotrophus [TaxId:82367]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P72181 (Start-566)
      • conflict (159)
      • conflict (184)
      • conflict (190)
      • conflict (330)
    Domains in SCOPe 2.06: d1aoma1
  • Chain 'B':
    Compound: nitrite reductase
    Species: Paracoccus pantotrophus [TaxId:82367]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P72181 (Start-566)
      • conflict (159)
      • conflict (184)
      • conflict (190)
      • conflict (330)
    Domains in SCOPe 2.06: d1aomb1, d1aomb2
  • Heterogens: DHE, 2NO, HEM, NO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1aomA (A:)
    qeqvappkdpaaaledhktrtdnryepsldnlaqqdvaapgapegvtalsdaqyneanki
    yfercagchgvlrkgatgkaltpdltrdlgfdylqsfityaspagmpnwgtsgelsaeqv
    dlmanyllldpaappefgmkemreswkvhvapedrptqqmndwdlenlfsvtlrdagqia
    lidgstyeiktvldtgyavhisrlsasgrylfvigrdgkvnmidlwmkepttvaeikigs
    earsietskmegwedkyaiagaywppqyvimdgetlepkkiqstrgmtydeqeyhpeprv
    aailashyrpefivnvketgkillvdytdlnnlktteisaerflhdggldgshryfitaa
    narnklvvidtkegklvaiedtggqtphpgrganfvhptfgpvwatshmgddsvaligtd
    peghpdnawkildsfpalgggslfikthpnsqylyvdatlnpeaeisgsvavfdikamtg
    dgsdpefktlpiaewagitegqprvvqgefnkdgtevwfsvwngkdqesalvvvddktle
    lkhvikderlvtptgkfnvyntmtdty
    

    Sequence, based on observed residues (ATOM records): (download)
    >1aomA (A:)
    ldpaappefgmkemreswkvhvapedrptqqmndwdlenlfsvtlrdagqialidgstye
    iktvldtgyavhisrlsasgrylfvigrdgkvnmidlwmkepttvaeikigsearsiets
    kmegwedkyaiagaywppqyvimdgetlepkkiqstrgmtydeqeyhpeprvaailashy
    rpefivnvketgkillvdytdlnnlktteisaerflhdggldgshryfitaanarnklvv
    idtkegklvaiedtggqtphpgrganfvhptfgpvwatshmgddsvaligtdpeghpdna
    wkildsfpalgggslfikthpnsqylyvdatlnpeaeisgsvavfdikamtgdgsdpefk
    tlpiaewagitegqprvvqgefnkdgtevwfsvwngkdqesalvvvddktlelkhvikde
    rlvtptgkfnvyntmtdty
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1aomB (B:)
    qeqvappkdpaaaledhktrtdnryepsldnlaqqdvaapgapegvtalsdaqyneanki
    yfercagchgvlrkgatgkaltpdltrdlgfdylqsfityaspagmpnwgtsgelsaeqv
    dlmanyllldpaappefgmkemreswkvhvapedrptqqmndwdlenlfsvtlrdagqia
    lidgstyeiktvldtgyavhisrlsasgrylfvigrdgkvnmidlwmkepttvaeikigs
    earsietskmegwedkyaiagaywppqyvimdgetlepkkiqstrgmtydeqeyhpeprv
    aailashyrpefivnvketgkillvdytdlnnlktteisaerflhdggldgshryfitaa
    narnklvvidtkegklvaiedtggqtphpgrganfvhptfgpvwatshmgddsvaligtd
    peghpdnawkildsfpalgggslfikthpnsqylyvdatlnpeaeisgsvavfdikamtg
    dgsdpefktlpiaewagitegqprvvqgefnkdgtevwfsvwngkdqesalvvvddktle
    lkhvikderlvtptgkfnvyntmtdty
    

    Sequence, based on observed residues (ATOM records): (download)
    >1aomB (B:)
    dpaaaledhktrtdnryepsldnlaqqdvaapgapegvtalsdaqyneankiyfercagc
    hgvlrkgatgkaltpdltrdlgfdylqsfityaspagmpnwgtsgelsaeqvdlmanyll
    ldpaappefgmkemreswkvhvapedrptqqmndwdlenlfsvtlrdagqialidgstye
    iktvldtgyavhisrlsasgrylfvigrdgkvnmidlwmkepttvaeikigsearsiets
    kmegwedkyaiagaywppqyvimdgetlepkkiqstrgmtydeqeyhpeprvaailashy
    rpefivnvketgkillvdytdlnnlktteisaerflhdggldgshryfitaanarnklvv
    idtkegklvaiedtggqtphpgrganfvhptfgpvwatshmgddsvaligtdpeghpdna
    wkildsfpalgggslfikthpnsqylyvdatlnpeaeisgsvavfdikamtgdgsdpefk
    tlpiaewagitegqprvvqgefnkdgtevwfsvwngkdqesalvvvddktlelkhvikde
    rlvtptgkfnvyntmtdty