PDB entry 1aom

View 1aom on RCSB PDB site
Description: substrate and product bound to cytochrome cd1 nitrite reductase
Deposited on 1997-07-08, released 1998-02-04
The last revision prior to the SCOP 1.55 freeze date was dated 1998-02-04, with a file datestamp of 1998-02-04.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.181
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1aomA (A:)
    ldpaappefgmkemreswkvhvapedrptqqmndwdlenlfsvtlrdagqialidgstye
    iktvldtgyavhisrlsasgrylfvigrdgkvnmidlwmkepttvaeikigsearsiets
    kmegwedkyaiagaywppqyvimdgetlepkkiqstrgmtydeqeyhpeprvaailashy
    rpefivnvketgkillvdytdlnnlktteisaerflhdggldgshryfitaanarnklvv
    idtkegklvaiedtggqtphpgrganfvhptfgpvwatshmgddsvaligtdpeghpdna
    wkildsfpalgggslfikthpnsqylyvdatlnpeaeisgsvavfdikamtgdgsdpefk
    tlpiaewagitegqprvvqgefnkdgtevwfsvwngkdqesalvvvddktlelkhvikde
    rlvtptgkfnvyntmtdty
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1aomB (B:)
    dpaaaledhktrtdnryepsldnlaqqdvaapgapegvtalsdaqyneankiyfercagc
    hgvlrkgatgkaltpdltrdlgfdylqsfityaspagmpnwgtsgelsaeqvdlmanyll
    ldpaappefgmkemreswkvhvapedrptqqmndwdlenlfsvtlrdagqialidgstye
    iktvldtgyavhisrlsasgrylfvigrdgkvnmidlwmkepttvaeikigsearsiets
    kmegwedkyaiagaywppqyvimdgetlepkkiqstrgmtydeqeyhpeprvaailashy
    rpefivnvketgkillvdytdlnnlktteisaerflhdggldgshryfitaanarnklvv
    idtkegklvaiedtggqtphpgrganfvhptfgpvwatshmgddsvaligtdpeghpdna
    wkildsfpalgggslfikthpnsqylyvdatlnpeaeisgsvavfdikamtgdgsdpefk
    tlpiaewagitegqprvvqgefnkdgtevwfsvwngkdqesalvvvddktlelkhvikde
    rlvtptgkfnvyntmtdty