PDB entry 1aol

View 1aol on RCSB PDB site
Description: friend murine leukemia virus receptor-binding domain
Class: Viral protein
Keywords: COAT PROTEIN, VIRAL GLYCOPROTEIN, RETROVIRUS, Viral protein
Deposited on 1997-07-08, released 1997-10-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.223
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: gp70
    Species: Friend murine leukemia virus [TaxId:11795]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1aola_
  • Heterogens: NAG, ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1aolA (A:)
    qvynitwevtngdretvwaisgnhplwtwwpvltpdlcmlalsgpphwgleyqapysspp
    gppccsgssgssagcsrdcdepltsltprcntawnrlkldqvthkssegfyvcpgshrpr
    eakscggpdsfycaswgcettgrvywkpssswdyitvdnnlttsqavqvckdnkwcnpla
    iqftnagkqvtswttghywglrlyvsgrdpgltfgirlryqnlgprvp