PDB entry 1aok

View 1aok on RCSB PDB site
Description: vipoxin complex
Class: hydrolase
Keywords: phospholipase, hydrolase, vipoxin, pla2-activity, snake-venom
Deposited on 1997-07-07, released 1998-01-21
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.16
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: vipoxin complex
    Species: Vipera ammodytes meridionalis [TaxId:73841]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P04084 (0-121)
      • conflict (60)
      • conflict (67)
      • conflict (77)
    Domains in SCOPe 2.06: d1aoka_
  • Chain 'B':
    Compound: vipoxin complex
    Species: Vipera ammodytes meridionalis [TaxId:73841]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P14420 (0-121)
      • conflict (64)
      • conflict (104)
      • conflict (118)
      • conflict (120)
    Domains in SCOPe 2.06: d1aokb_
  • Heterogens: ACT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1aokA (A:)
    nlfqfgdmilqktgkeavhsyaiygcycgwggqgraqdatdrccfaqdccygrvndcnpk
    tatytysrengdivcgdddlclravcecdraaaiclgenvntydknyeyysishcteese
    qc
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1aokB (B:)
    nlfqfakmingklgafsvwnyisygcycgwggqgtpkdatdrccfvhdccygrvrgcnpk
    laiyyysfkkgnivcgknngclrdicecdrvaancfhqnkntynanykflsssrcrqtge
    kc