PDB entry 1aoj

View 1aoj on RCSB PDB site
Description: the sh3 domain of eps8 exists as a novel intertwined dimer
Deposited on 1997-07-07, released 1998-07-08
The last revision prior to the SCOP 1.57 freeze date was dated 1998-07-08, with a file datestamp of 1998-07-08.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.193
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.57: d1aoja_
  • Chain 'B':
    Domains in SCOP 1.57: d1aojb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1aojA (A:)
    kkyakskydfvarnsselsvmkddvleilddrrqwwkvrnasgdsgfvpnnildimrtpe
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1aojB (B:)
    kkyakskydfvarnsselsvmkddvleilddrrqwwkvrnasgdsgfvpnnildimrtpe