PDB entry 1aoi

View 1aoi on RCSB PDB site
Description: complex between nucleosome core particle (h3,h4,h2a,h2b) and 146 bp long DNA fragment
Class: DNA binding protein/DNA
Keywords: nucleosome, chromatin, histone, protein DNA interaction, nucleoprotein, supercoiled DNA, DNA binding protein/DNA complex
Deposited on 1997-07-03, released 1998-09-30
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.224
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: histone h3
    Species: Xenopus laevis [TaxId:8355]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02302 (Start-115)
      • conflict (66)
    Domains in SCOPe 2.06: d1aoia_
  • Chain 'B':
    Compound: histone h4
    Species: Xenopus laevis, synthetic [TaxId:8355]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1aoib_
  • Chain 'C':
    Compound: histone h2a
    Species: Xenopus laevis [TaxId:8355]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P06897 (0-End)
      • conflict (95)
    Domains in SCOPe 2.06: d1aoic_
  • Chain 'D':
    Compound: histone h2b
    Species: Xenopus laevis [TaxId:8355]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02281 (0-98)
      • conflict (5)
    Domains in SCOPe 2.06: d1aoid_
  • Chain 'E':
    Compound: histone h3
    Species: Xenopus laevis [TaxId:8355]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02302 (0-115)
      • conflict (1)
      • conflict (6)
      • conflict (8)
      • conflict (66)
    Domains in SCOPe 2.06: d1aoie_
  • Chain 'F':
    Compound: histone h4
    Species: Xenopus laevis, synthetic [TaxId:8355]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1aoif_
  • Chain 'G':
    Compound: histone h2a
    Species: Xenopus laevis [TaxId:8355]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P06897 (Start-115)
      • conflict (95)
    Domains in SCOPe 2.06: d1aoig_
  • Chain 'H':
    Compound: histone h2b
    Species: Xenopus laevis [TaxId:8355]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02281 (0-98)
      • conflict (5)
    Domains in SCOPe 2.06: d1aoih_
  • Chain 'I':
    Compound: palindromic 146 bp DNA repeat 8/9 from human x-chromosome alpha satellite DNA
  • Chain 'J':
    Compound: palindromic 146 bp DNA repeat 8/9 from human x-chromosome alpha satellite DNA
  • Heterogens: MN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1aoiA (A:)
    latkaarksapatggvkkphryrpgtvalreirryqkstellirklpfqrlvreiaqdfk
    tdlrfqssavmalqeaseaylvalfedtnlcaihakrvtimpkdiqlarrirgera
    

    Sequence, based on observed residues (ATOM records): (download)
    >1aoiA (A:)
    phryrpgtvalreirryqkstellirklpfqrlvreiaqdfktdlrfqssavmalqease
    aylvalfedtnlcaihakrvtimpkdiqlarrirgera
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1aoiB (B:)
    krhrkvlrdniqgitkpairrlarrggvkrisgliyeetrgvlkvflenvirdavtyteh
    akrktvtamdvvyalkrqgrtlygfgg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1aoiB (B:)
    kvlrdniqgitkpairrlarrggvkrisgliyeetrgvlkvflenvirdavtytehakrk
    tvtamdvvyalkrqgrtlygfgg
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1aoiC (C:)
    gkqggktrakaktrssraglqfpvgrvhrllrkgnyaervgagapvylaavleyltaeil
    elagnaardnkktriiprhlqlavrndeelnkllgrvtiaqggvlpniqsvllpkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1aoiC (C:)
    gkqggktrakaktrssraglqfpvgrvhrllrkgnyaervgagapvylaavleyltaeil
    elagnaardnkktriiprhlqlavrndeelnkllgrvtiaqggvlpniqsvllpk
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1aoiD (D:)
    kkrrktrkesyaiyvykvlkqvhpdtgisskamsimnsfvndvferiageasrlahynkr
    stitsreiqtavrlllpgelakhavsegtkavtkytsak
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1aoiE (E:)
    latkaarksapatggvkkphryrpgtvalreirryqkstellirklpfqrlvreiaqdfk
    tdlrfqssavmalqeaseaylvalfedtnlcaihakrvtimpkdiqlarrirgera
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1aoiF (F:)
    krhrkvlrdniqgitkpairrlarrggvkrisgliyeetrgvlkvflenvirdavtyteh
    akrktvtamdvvyalkrqgrtlygfgg
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >1aoiG (G:)
    gkqggktrakaktrssraglqfpvgrvhrllrkgnyaervgagapvylaavleyltaeil
    elagnaardnkktriiprhlqlavrndeelnkllgrvtiaqggvlpniqsvllpkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1aoiG (G:)
    akaktrssraglqfpvgrvhrllrkgnyaervgagapvylaavleyltaeilelagnaar
    dnkktriiprhlqlavrndeelnkllgrvtiaqggvlpniqsvllpkk
    

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1aoiH (H:)
    kkrrktrkesyaiyvykvlkqvhpdtgisskamsimnsfvndvferiageasrlahynkr
    stitsreiqtavrlllpgelakhavsegtkavtkytsak
    

  • Chain 'I':
    No sequence available.

  • Chain 'J':
    No sequence available.