PDB entry 1aoh

View 1aoh on RCSB PDB site
Description: single cohesin domain from the scaffolding protein cipa of the clostridium thermocellum cellulosome
Class: cellulosome subunit
Keywords: cellulosome subunit, b-barrel, cellulose degradation
Deposited on 1997-07-03, released 1998-07-08
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.194
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cellulosome-integrating protein cipa
    Species: Clostridium thermocellum [TaxId:1515]
    Gene: lacI
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1aoha_
  • Chain 'B':
    Compound: cellulosome-integrating protein cipa
    Species: Clostridium thermocellum [TaxId:1515]
    Gene: lacI
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q06851 (0-146)
      • conflict (0)
      • cloning artifact (0)
    Domains in SCOPe 2.06: d1aohb1, d1aohb2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1aohA (A:)
    tdldavrikvdtvnakpgdtvripvrfsgipskgiancdfvysydpnvleiieiepgeli
    vdpnptksfdtavypdrkmivflfaedsgtgayaitedgvfativakvksgapnglsvik
    fvevggfanndlveqktqffdggvnvg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1aohA (A:)
    avrikvdtvnakpgdtvripvrfsgipskgiancdfvysydpnvleiieiepgelivdpn
    ptksfdtavypdrkmivflfaedsgtgayaitedgvfativakvksgapnglsvikfvev
    ggfanndlveqktqffdggvnvg
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1aohB (B:)
    tdldavrikvdtvnakpgdtvripvrfsgipskgiancdfvysydpnvleiieiepgeli
    vdpnptksfdtavypdrkmivflfaedsgtgayaitedgvfativakvksgapnglsvik
    fvevggfanndlveqktqffdggvnvg