PDB entry 1aog

View 1aog on RCSB PDB site
Description: trypanosoma cruzi trypanothione reductase (oxidized form)
Class: oxidoreductase
Keywords: trypanothione reductase, fad dependent disulphide oxidoreductase
Deposited on 1997-07-03, released 1997-09-17
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.189
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: trypanothione reductase
    Species: Trypanosoma cruzi [TaxId:5693]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1aoga1, d1aoga2, d1aoga3
  • Chain 'B':
    Compound: trypanothione reductase
    Species: Trypanosoma cruzi [TaxId:5693]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1aogb1, d1aogb2, d1aogb3
  • Heterogens: FAD, MAE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1aogA (A:)
    skifdlvvigagsggleaawnaatlykkrvavidvqmvhgppffsalggtcvnvgcvpkk
    lmvtgaqymehlresagfgwefdrttlraewknliavkdeavlninksydemfrdtegle
    fflgwgslesknvvnvresadpasavkerletehillasgswphmpnipgiehcissnea
    fylpepprrvltvgggfisvefagifnaykpkdgqvtlcyrgemilrgfdhtlreeltkq
    ltangiqiltkenpakvelnadgsksvtfesgkkmdfdlvmmaigrsprtkdlqlqnagv
    miknggvqvdeysrtnvsniyaigdvtnrvmltpvaineaaalvdtvfgttprktdhtrv
    asavfsippigtcglieevaskryevvavylssftplmhkvsgskyktfvakiitnhsdg
    tvlgvhllgdnapeiiqgigiclklnakisdfyntigvhptsaeelcsmrtpsyyyvkge
    kmekp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1aogB (B:)
    skifdlvvigagsggleaawnaatlykkrvavidvqmvhgppffsalggtcvnvgcvpkk
    lmvtgaqymehlresagfgwefdrttlraewknliavkdeavlninksydemfrdtegle
    fflgwgslesknvvnvresadpasavkerletehillasgswphmpnipgiehcissnea
    fylpepprrvltvgggfisvefagifnaykpkdgqvtlcyrgemilrgfdhtlreeltkq
    ltangiqiltkenpakvelnadgsksvtfesgkkmdfdlvmmaigrsprtkdlqlqnagv
    miknggvqvdeysrtnvsniyaigdvtnrvmltpvaineaaalvdtvfgttprktdhtrv
    asavfsippigtcglieevaskryevvavylssftplmhkvsgskyktfvakiitnhsdg
    tvlgvhllgdnapeiiqgigiclklnakisdfyntigvhptsaeelcsmrtpsyyyvkge
    kmekp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1aogB (B:)
    ifdlvvigagsggleaawnaatlykkrvavidvqmvhgppffsalggtcvnvgcvpkklm
    vtgaqymehlresagfgwefdrttlraewknliavkdeavlninksydemfrdtegleff
    lgwgslesknvvnvresadpasavkerletehillasgswphmpnipgiehcissneafy
    lpepprrvltvgggfisvefagifnaykpkdgqvtlcyrgemilrgfdhtlreeltkqlt
    angiqiltkenpakvelnadgsksvtfesgkkmdfdlvmmaigrsprtkdlqlqnagvmi
    knggvqvdeysrtnvsniyaigdvtnrvmltpvaineaaalvdtvfgttprktdhtrvas
    avfsippigtcglieevaskryevvavylssftplmhkvsgskyktfvakiitnhsdgtv
    lgvhllgdnapeiiqgigiclklnakisdfyntigvhptsaeelcsmrtpsyyyvkgekm
    ekp