PDB entry 1aof

View 1aof on RCSB PDB site
Description: cytochrome cd1 nitrite reductase, reduced form
Deposited on 1997-07-02, released 1997-10-15
The last revision prior to the SCOP 1.55 freeze date was dated 1997-10-15, with a file datestamp of 1997-10-15.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.201
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1aofA (A:)
    dvaapgapegvtalsdaqyneankiyfercagchgvlrkgatgkaltpdltrdlgfdylq
    sfityaspagmpnwgtsgelsaeqvdlmanyllldpaappefgmkemreswkvhvapedr
    ptqqmndwdlenlfsvtlrdagqialidgstyeiktvldtgyavhisrlsasgrylfvig
    rdgkvnmidlwmkepttvaeikigsearsietskmegwedkyaiagaywppqyvimdget
    lepkkiqstrgmtydeqeyhpeprvaailashyrpefivnvketgkillvdytdlnnlkt
    teisaerflhdggldgshryfitaanarnklvvidtkegklvaiedtggqtphpgrganf
    vhptfgpvwatshmgddsvaligtdpeghpdnawkildsfpalgggslfikthpnsqyly
    vdatlnpeaeisgsvavfdikamtgdgsdpefktlpiaewagitegqprvvqgefnkdgt
    evwfsvwngkdqesalvvvddktlelkhvikderlvtptgkfnvyntmtdty
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1aofB (B:)
    epsldnlaqqdvaapgapegvtalsdaqyneankiyfercagchgvlrkgatgkaltpdl
    trdlgfdylqsfityaspagmpnwgtsgelsaeqvdlmanyllldpaappefgmkemres
    wkvhvapedrptqqmndwdlenlfsvtlrdagqialidgstyeiktvldtgyavhisrls
    asgrylfvigrdgkvnmidlwmkepttvaeikigsearsietskmegwedkyaiagaywp
    pqyvimdgetlepkkiqstrgmtydeqeyhpeprvaailashyrpefivnvketgkillv
    dytdlnnlktteisaerflhdggldgshryfitaanarnklvvidtkegklvaiedtggq
    tphpgrganfvhptfgpvwatshmgddsvaligtdpeghpdnawkildsfpalgggslfi
    kthpnsqylyvdatlnpeaeisgsvavfdikamtgdgsdpefktlpiaewagitegqprv
    vqgefnkdgtevwfsvwngkdqesalvvvddktlelkhvikderlvtptgkfnvyntmtd
    ty