PDB entry 1aoe

View 1aoe on RCSB PDB site
Description: candida albicans dihydrofolate reductase complexed with dihydro-nicotinamide-adenine-dinucleotide phosphate (nadph) and 1,3-diamino-7-(1-ethyepropye)-7h-pyrralo-[3,2-f]quinazoline (gw345)
Class: oxidoreductase
Keywords: oxidoreductase, antifungal target, reductase
Deposited on 1997-07-02, released 1998-01-07
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.155
AEROSPACI score: 0.61 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: dihydrofolate reductase
    Species: Candida albicans [TaxId:5476]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1aoea_
  • Chain 'B':
    Compound: dihydrofolate reductase
    Species: Candida albicans [TaxId:5476]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1aoeb_
  • Heterogens: NDP, GW3, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1aoeA (A:)
    mlkpnvaiivaalkpalgigykgkmpwrlrkeiryfkdvttrttkpntrnavimgrktwe
    sipqkfrplpdrlniilsrsyeneiiddniihassiesslnlvsdvervfiiggaeiyne
    linnslvshlliteiehpspesiemdtflkfpleswtkqpkselqkfvgdtvleddikeg
    dftynytlwtrk
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1aoeB (B:)
    mlkpnvaiivaalkpalgigykgkmpwrlrkeiryfkdvttrttkpntrnavimgrktwe
    sipqkfrplpdrlniilsrsyeneiiddniihassiesslnlvsdvervfiiggaeiyne
    linnslvshlliteiehpspesiemdtflkfpleswtkqpkselqkfvgdtvleddikeg
    dftynytlwtrk