PDB entry 1aod

View 1aod on RCSB PDB site
Description: phosphatidylinositol-specific phospholipase c from listeria monocytogenes
Deposited on 1997-07-02, released 1998-01-07
The last revision prior to the SCOP 1.63 freeze date was dated 1998-01-07, with a file datestamp of 1998-01-07.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.158
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.63: d1aod__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1aod_ (-)
    vttkqwmsalpdttnlaalsipgthdtmsyngditwtltkplaqtqtmslyqqleagiry
    idirakdnlniyhgpiflnaslsgvletitqflkknpketiimrlkdeqnsndsfdyriq
    pliniykdyfyttprtdtsnkiptlkdvrgkilllsenhtkkplvinsrkfgmqfgapnq
    viqddyngpsvktkfkeivqtayqaskadnklflnhisatsltftprqyaaalnnkveqf
    vlnltsekvrglgilimdfpekqtikniiknnkf