PDB entry 1aod

View 1aod on RCSB PDB site
Description: phosphatidylinositol-specific phospholipase c from listeria monocytogenes
Class: hydrolase
Keywords: hydrolase, phospholipid degradation, virulence factor of human pathogen
Deposited on 1997-07-02, released 1998-01-07
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.158
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: phosphatidylinositol-specific phospholipase c
    Species: Listeria monocytogenes [TaxId:1639]
    Gene: PLCA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1aoda_
  • Heterogens: INS, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1aodA (A:)
    ayslnnwnkpiknsvttkqwmsalpdttnlaalsipgthdtmsyngditwtltkplaqtq
    tmslyqqleagiryidirakdnlniyhgpiflnaslsgvletitqflkknpketiimrlk
    deqnsndsfdyriqpliniykdyfyttprtdtsnkiptlkdvrgkilllsenhtkkplvi
    nsrkfgmqfgapnqviqddyngpsvktkfkeivqtayqaskadnklflnhisatsltftp
    rqyaaalnnkveqfvlnltsekvrglgilimdfpekqtikniiknnkfn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1aodA (A:)
    vttkqwmsalpdttnlaalsipgthdtmsyngditwtltkplaqtqtmslyqqleagiry
    idirakdnlniyhgpiflnaslsgvletitqflkknpketiimrlkdeqnsndsfdyriq
    pliniykdyfyttprtdtsnkiptlkdvrgkilllsenhtkkplvinsrkfgmqfgapnq
    viqddyngpsvktkfkeivqtayqaskadnklflnhisatsltftprqyaaalnnkveqf
    vlnltsekvrglgilimdfpekqtikniiknnkf