PDB entry 1aoc

View 1aoc on RCSB PDB site
Description: japanese horseshoe crab coagulogen
Class: coagulation factor
Keywords: coagulation factor, clottable protein, cystine knot superfamily
Deposited on 1996-11-28, released 1997-04-21
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.191
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: coagulogen
    Species: Tachypleus tridentatus [TaxId:6853]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02681 (0-174)
      • variant (85)
    Domains in SCOPe 2.07: d1aoca_
  • Chain 'B':
    Compound: coagulogen
    Species: Tachypleus tridentatus [TaxId:6853]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02681 (0-174)
      • variant (85)
    Domains in SCOPe 2.07: d1aocb_
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1aocA (A:)
    adtnapiclcdepgvlgrtqivtteikdkiekaveavaqesgvsgrgfsifshhpvfrec
    gkyecrtvrpehsrcynfppfthfksecpvstrdcepvfgytvagefrvivqapragfrq
    cvwqhkcrfgsnscgyngrctqqrsvvrlvtynlekdgflcesfrtccgcpcrsf
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1aocB (B:)
    adtnapiclcdepgvlgrtqivtteikdkiekaveavaqesgvsgrgfsifshhpvfrec
    gkyecrtvrpehsrcynfppfthfksecpvstrdcepvfgytvagefrvivqapragfrq
    cvwqhkcrfgsnscgyngrctqqrsvvrlvtynlekdgflcesfrtccgcpcrsf